PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 570aa    MW: 64484.9 Da    PI: 4.4657
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016897genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS292.98.5e-901975643373
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  e Ll +Ae + ++++e+a +lL++   ++s +gdp+qRl+ yf +AL +r+ r + ++++++ p  ++ +  +      +  f+e  P+ ++s ++a 
  Lus10016897 197 EFLLMAAEKIGDEQFERAGSLLTECDLQSSATGDPVQRLVYYFSQALWERIDRqTKKQTVEKSPKIPKVQAMMMPPRECFLEFYEKVPFAQVSEFAAI 294
                  67999************************************************33333333333333332223333344445**************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  qa++++v++++r+Hi+Df+i++G QW  ++qaL sR+e++p  +++iT++g    + ke+leetg+rL  fAe+++++f+f+++++++l dl+ e+++
  Lus10016897 295 QAVVDSVATSRRIHIVDFNIKNGEQWTIFMQALVSREESTPvdHVKITAIGT---VGKEMLEETGKRLIGFAEAMKLSFSFKLVMVEDLLDLKEEMFE 389
                  *************************************888888*********...79***************************************** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++ +E++aV + +   +l ++ v+     d v+k++++++P v+vv+e e++hns+ F++rf+eal y+sa fd+le+ + r++ +r + E  ++g+ 
  Lus10016897 390 IDCDETVAVLSEYLFTTLISSVVK----LDYVMKMIWKIKPCVMVVTEVESNHNSPVFVNRFIEALFYVSAYFDCLETCMERDNPHRLFAESSFFGEG 483
                  *************77777744444....556******************************************************************* PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                   + vva+eg+er  r+ t+  Wr+ ++++G++++ ls + + qa+l+ +k++ ++  +v+ + +sl+ gWk+ p+ sv+aW
  Lus10016897 484 TKIVVANEGEERAIRNVTMDVWRAYFRRFGMEEADLSLSCVYQAELVAKKFPcWRSCTVDLDGKSLIVGWKGTPIHSVTAW 564
                  *****************************************************9*************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.256169544IPR005202Transcription factor GRAS
PfamPF035142.9E-87197564IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MAHQISSFQF NNGGIQDQHL SVSNQSFDSD PISLFESWIA RDHDHQSLFP SYDNNDEDYP  60
LIHHQSIMIS DPQAISDDFN GIVNRQVSVD SSDEQIINGN LEIPNSDSAS SLFDMLRVAR  120
NGSRKRNSSF LTVHKSSDDS VIDAVDSVGF STEELIRIAG AKFIHFSSEL GDSVTSSFDL  180
TFFGLSDEEL KNVELAEFLL MAAEKIGDEQ FERAGSLLTE CDLQSSATGD PVQRLVYYFS  240
QALWERIDRQ TKKQTVEKSP KIPKVQAMMM PPRECFLEFY EKVPFAQVSE FAAIQAVVDS  300
VATSRRIHIV DFNIKNGEQW TIFMQALVSR EESTPVDHVK ITAIGTVGKE MLEETGKRLI  360
GFAEAMKLSF SFKLVMVEDL LDLKEEMFEI DCDETVAVLS EYLFTTLISS VVKLDYVMKM  420
IWKIKPCVMV VTEVESNHNS PVFVNRFIEA LFYVSAYFDC LETCMERDNP HRLFAESSFF  480
GEGTKIVVAN EGEERAIRNV TMDVWRAYFR RFGMEEADLS LSCVYQAELV AKKFPCWRSC  540
TVDLDGKSLI VGWKGTPIHS VTAWNFNCE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3621456522375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM5XKD71e-166M5XKD7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15350.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-54RGA-like 2